Structure of PDB 8oit Chain Bb |
>8oitBb (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] |
AAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSV IADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAG S |
|
PDB | 8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria. |
Chain | Bb |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Bb |
A2 L84 |
A1 L83 |
|
|
|
|