Structure of PDB 4uje Chain Bb

Receptor sequence
>4ujeBb (length=80) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
AKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTV
VLCVGCSTVLCQPTGGKARLTEGCSFRRKQ
3D structure
PDB4uje Regulation of the Mammalian Elongation Cycle by Subunit Rolling: A Eukaryotic-Specific Ribosome Rearrangement.
ChainBb
Resolution6.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bb R17 H19 K20 K21 Q26 P28 S30 F47 H49 Q51 P66 G68 G69 K70 E75 R14 H16 K17 K18 Q23 P25 S27 F44 H46 Q48 P63 G65 G66 K67 E72
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:38:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4uje', asym_id = 'Bb', title = 'Regulation of the Mammalian Elongation Cycle by ...ng: A Eukaryotic-Specific Ribosome Rearrangement.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4uje', asym_id='Bb', title='Regulation of the Mammalian Elongation Cycle by ...ng: A Eukaryotic-Specific Ribosome Rearrangement.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4uje', asym_id = 'Bb'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4uje', asym_id='Bb')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>