Structure of PDB 8oir Chain Ba

Receptor sequence
>8oirBa (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
AGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERET
FARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASL
3D structure
PDB8oir Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
ChainBa
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ba A23 G24 G25 N36 P37 S38 K61 G62 R65 R66 R76 A1 G2 G3 N14 P15 S16 K39 G40 R43 R44 R54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oir, PDBe:8oir, PDBj:8oir
PDBsum8oir
PubMed37141370
UniProtQ86TS9|RM52_HUMAN Large ribosomal subunit protein mL52 (Gene Name=MRPL52)

[Back to BioLiP]