Structure of PDB 8off Chain Ba

Receptor sequence
>8offBa (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
3D structure
PDB8off BRCA1-BARD1 combines multiple chromatin recognition modules to bridge nascent nucleosomes
ChainBa
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Ba S57 S88 T89 S24 S55 T56
BS02 dna Ba R34 E36 R1 E3
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8off, PDBe:8off, PDBj:8off
PDBsum8off
PubMed37823591
UniProtP62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I (Gene Name=H2BC4)

[Back to BioLiP]