Structure of PDB 6uz7 Chain Ba

Receptor sequence

>6uz7Ba (length=147) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

PTRLTKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGLHHHRTNLDKYHPG
YFGKVGMRYFHKQQAHFWKPVLNLDKLWTLVPEEKREEYLKSASKSAAPV
IDTLAAGYGKVLGKGRIPDVPVIVKARFVSKLAEEKIKAAGGVVELI

3D structure

PDB

6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ba	P2 T3 R4 T6 K7 T8 R9 R12 H14 V15 G18 K19 G20 R21 V22 G23 H25 R26 K27 H28 P29 G30 G31 R32 G33 M34 G36 H40 H41 R42 T43 N44 Y48 Y52 F53 G54 K55 G57 M58 R59 Y60 F61 H62 K63 H67 V72 N74 K77 K111 L113 G114 K115 R117 S131 K132 L133	P1 T2 R3 T5 K6 T7 R8 R11 H13 V14 G17 K18 G19 R20 V21 G22 H24 R25 K26 H27 P28 G29 G30 R31 G32 M33 G35 H39 H40 R41 T42 N43 Y47 Y51 F52 G53 K54 G56 M57 R58 Y59 F60 H61 K62 H66 V71 N73 K76 K110 L112 G113 K114 R116 S130 K131 L132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links