Structure of PDB 6olz Chain Ba

Receptor sequence
>6olzBa (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPP
3D structure
PDB6olz Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
ChainBa
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ba T2 K3 K4 R5 R6 N7 N8 G9 R10 K12 K13 G14 R15 G16 H17 K34 K37 F39 K70 V75 S76 I79 K82 V84 R87 S88 R89 R92 R95 T96 P97 T1 K2 K3 R4 R5 N6 N7 G8 R9 K11 K12 G13 R14 G15 H16 K33 K36 F38 K69 V74 S75 I78 K81 V83 R86 S87 R88 R91 R94 T95 P96
BS02 ZN Ba C26 C77 C25 C76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6olz, PDBe:6olz, PDBj:6olz
PDBsum6olz
PubMed31160784
UniProtP62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)

[Back to BioLiP]