Structure of PDB 4v6u Chain Ba

Receptor sequence
>4v6uBa (length=90) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
KAGEEVIFTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPK
VNEKIWERGIEKPPSKLRVKVKVEEEKREGEETVRIAYVT
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainBa
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ba F11 P14 K17 K19 K20 I21 P23 R24 W25 R30 R36 R41 H42 W59 R61 I63 E64 K65 F8 P11 K14 K16 K17 I18 P20 R21 W22 R27 R33 R38 H39 W56 R58 I60 E61 K62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U3S7|RL31_PYRFU Large ribosomal subunit protein eL31 (Gene Name=rpl31e)

[Back to BioLiP]