Structure of PDB 8ova Chain BZ

Receptor sequence

>8ovaBZ (length=122) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

GIKCRNRRKARRAHFQAPSHVRRILMSAPLSKELRAKYNVRSMPVRKDDE
VRVKRGKFKGREGRVTACYRLKWVIHIDKVSCEKANGTTVPVGVHTSNVE
ITKLKLNTRRKAILERKDRSTK

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BZ	K5 C6 R7 R13 I26 L27 S29 P31 R43 R57 G58 K59 C84 K86 A87 H97 S99 N100 K119 R121	K3 C4 R5 R11 I24 L25 S27 P29 R41 R55 G56 K57 C82 K84 A85 H95 S97 N98 K117 R119
BS02	rna	BZ	R10 R13 R14 H22 R25 R48 Y71 R72 R111 I115 R118	R8 R11 R12 H20 R23 R46 Y69 R70 R109 I113 R116

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

External links