Structure of PDB 8evt Chain BZ

Receptor sequence
>8evtBZ (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
QHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKE
GIIKPISKHSKQAIYTRAT
3D structure
PDB8evt Regulation of translation by ribosomal RNA pseudouridylation.
ChainBZ
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BZ R49 E53 Y57 R58 Y59 R68 K70 R13 E17 Y21 R22 Y23 R32 K34
BS02 C BZ H95 S96 H59 S60
BS03 U BZ R77 R81 K97 R41 R45 K61
BS04 C BZ S74 R77 S38 R41
BS05 G BZ G73 S74 R77 G37 S38 R41
External links