Structure of PDB 8evr Chain BZ

Receptor sequence
>8evrBZ (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
QHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKE
GIIKPISKHSKQAIYTRAT
3D structure
PDB8evr Regulation of translation by ribosomal RNA pseudouridylation.
ChainBZ
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BZ E53 R58 D67 R68 E17 R22 D31 R32
BS02 C BZ K94 H95 S96 K58 H59 S60
BS03 G BZ R81 K97 R45 K61
BS04 U BZ R77 K97 R41 K61
BS05 C BZ S74 R77 S38 R41
BS06 G BZ G73 R77 G37 R41
External links