Structure of PDB 8c3a Chain BZ

Receptor sequence

>8c3aBZ (length=124) Species: 5476 (Candida albicans)

TSVPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTIP
QPNIGYGSNKKTKFLNPAGYKVYLVKNVKDLDVLLLHTKSYAAEIASSVS
SRKRVEIVAKAKKLGVKVTNPKGK

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: BZ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BZ	T3 K12 K13 Y14 T15 K16 F18 R20 H22 D24 R25 Y26 H27 R28 V29 W33 R34 K35 K37 G38 I39 D40 S41 C42 R44 R45 R46 F47 R48 G49 P52 P54 N55 I56 G57 Y58 G59 S60 N61 K62 K63 K65 F66 L67 P69 L76 K78 N79 E96 I97 A98 S99 S100 S102 R104 K105 K114 G117 N122 G125	T1 K10 K11 Y12 T13 K14 F16 R18 H20 D22 R23 Y24 H25 R26 V27 W31 R32 K33 K35 G36 I37 D38 S39 C40 R42 R43 R44 F45 R46 G47 P50 P52 N53 I54 G55 Y56 G57 S58 N59 K60 K61 K63 F64 L65 P67 L74 K76 N77 E94 I95 A96 S97 S98 S100 R102 K103 K112 G115 N120 G123
BS02	MG	BZ	K17 N32	K15 N30
BS03	MG	BZ	V101 R106	V99 R104
BS04	MG	BZ	H27 V29	H25 V27

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: O94008|RL32_CANAX Large ribosomal subunit protein eL32 (Gene Name=RPL32)