Structure of PDB 7zs5 Chain BZ

Receptor sequence

>7zs5BZ (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AKQSLDVSSDRRKARKAYFTAPSSSAPLSKELRAQYGIKALPIRRDDEVL
VVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVIT
KLHLDKDRKALIQRKGGKLE

3D structure

PDB

7zs5 Structural basis for clearing of ribosome collisions by the RQT complex.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BZ	A2 Q4 S5 S9 S10 R12 K14 R16 Y19 S32 P34 K37 K46 R60 G61 S62 K87 K89 V90 H100 S102 K103 K122	A1 Q3 S4 S8 S9 R11 K13 R15 Y18 S25 P27 K30 K39 R53 G54 S55 K80 K82 V83 H93 S95 K96 K115
BS02	rna	BZ	R12 R13 R16 K17 F20 P23 S25 R51 R52 Y74 R75 L76 D112 K113 D114	R11 R12 R15 K16 F19 P22 S24 R44 R45 Y67 R68 L69 D105 K106 D107

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7zs5, PDBe:7zs5, PDBj:7zs5
PDBsum	7zs5
PubMed	36801861
UniProt	P05743\|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)