Structure of PDB 4v6i Chain BZ

Receptor sequence
>4v6iBZ (length=73) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIA
WTVLFRKHHKKGITEEVAKKRSR
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBZ
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BZ R17 S34 Q42 R48 I49 W51 T52 R56 E65 S72 R17 S34 Q42 R48 I49 W51 T52 R56 E65 S72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006413 translational initiation
GO:0006414 translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP04449|RL24A_YEAST Large ribosomal subunit protein eL24A (Gene Name=RPL24A)

[Back to BioLiP]