Structure of PDB 4v4z Chain BZ

Receptor sequence

>4v4zBZ (length=85) Species: 300852 (Thermus thermophilus HB8)

MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKN
VGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v4z Structural basis for messenger RNA movement on the ribosome.
• Chain: BZ
• Resolution: 4.51 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BZ	A2 K4 G6 L7 G8	A2 K4 G6 L7 G8
BS02	rna	BZ	M1 A2 H3 L7 S9 R11 N12 R14 D15 S16 Q17 K19 R20 V23 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 F69 D71 L75 R77	M1 A2 H3 L7 S9 R11 N12 R14 D15 S16 Q17 K19 R20 V23 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 F69 D71 L75 R77
BS03	rna	BZ	R72 R74 L75	R72 R74 L75

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
• PDBsum: 4v4z
• PubMed: 17051149
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)