Structure of PDB 4v4h Chain BZ

Receptor sequence
>4v4hBZ (length=70) Species: 562 (Escherichia coli) [Search protein sequence]
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNIPGSK
3D structure
PDB4v4h Structural analysis of kasugamycin inhibition of translation.
ChainBZ
Resolution3.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BZ M1 Y9 E10 E11 I12 T13 A14 C16 S17 N20 V21 I24 R25 T27 V28 G29 H30 N33 L34 F44 R49 T53 V57 M1 Y9 E10 E11 I12 T13 A14 C16 S17 N20 V21 I24 R25 T27 V28 G29 H30 N33 L34 F44 R49 T53 V57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:1904689 negative regulation of cytoplasmic translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4h, PDBe:4v4h, PDBj:4v4h
PDBsum4v4h
PubMed16998486
UniProtP0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]