Structure of PDB 3j9w Chain BZ

Receptor sequence

>3j9wBZ (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
• Chain: BZ
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BZ	K12 S17 T18 N20 R22 D23 S24 E25 A26 K27 R28 L29 K32 A34 D35 Q37 T40 G41 G42 S43 I44 R47 R49 G50 T51 Y54 G62 G63 D64 T66 F68 F77 R84 K85	K2 S7 T8 N10 R12 D13 S14 E15 A16 K17 R18 L19 K22 A24 D25 Q27 T30 G31 G32 S33 I34 R37 R39 G40 T41 Y44 G52 G53 D54 T56 F58 F67 R74 K75
BS02	rna	BZ	R79 F80 R82	R69 F70 R72

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
• PDBsum: 3j9w
• PubMed: 25903689
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)