Structure of PDB 6th6 Chain BY

Receptor sequence
>6th6BY (length=62) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]
ARWNVCSYCGREFEPGTGKMFVRNDGRVLFFCSSKCEKYYFMGRNPRKLK
WTKAFQEARLQR
3D structure
PDB6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBY
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY L61 Q62 L60 Q61
BS02 rna BY K20 S35 K36 K39 Y40 M43 R45 K51 W52 R60 R63 K19 S34 K35 K38 Y39 M42 R44 K50 W51 R59 R62
BS03 ZN BY C7 C10 C37 C6 C9 C36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum6th6
PubMed32555463
UniProtQ5JGR5|RL24E_THEKO Large ribosomal subunit protein eL24 (Gene Name=rpl24e)

[Back to BioLiP]