Structure of PDB 6c5l Chain BY

Receptor sequence
>6c5lBY (length=100) Species: 274 (Thermus thermophilus) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
3D structure
PDB6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
ChainBY
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY R2 M5 K9 S17 G18 K19 V30 L31 P32 Y35 K47 V49 R50 F60 H68 S70 K71 R73 R84 V85 R1 M4 K8 S16 G17 K18 V29 L30 P31 Y34 K46 V48 R49 F59 H67 S69 K70 R72 R83 V84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
PDBsum6c5l
PubMed29403017
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]