Structure of PDB 4v90 Chain BY

Receptor sequence
>4v90BY (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
3D structure
PDB4v90 Structure of EF-G-ribosome complex in a pretranslocation state.
ChainBY
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY R2 K4 V7 K8 K9 S17 G18 K19 V30 L31 K34 Y35 I44 K46 K47 A48 V49 F60 H68 S70 K71 R73 R84 V85 R97 R1 K3 V6 K7 K8 S16 G17 K18 V29 L30 K33 Y34 I43 K45 K46 A47 V48 F59 H67 S69 K70 R72 R83 V84 R96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v90, PDBe:4v90, PDBj:4v90
PDBsum4v90
PubMed23912278
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]