Structure of PDB 4v8h Chain BY

Receptor sequence
>4v8hBY (length=107) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALD
3D structure
PDB4v8h How Hibernation Factors RMF, HPF, and YfiA Turn Off Protein Synthesis.
ChainBY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY M1 R2 K4 H6 K8 S17 G18 K19 V30 P32 Y35 V45 K46 K47 A48 V49 V51 G59 F60 H68 S70 K71 R73 R84 R86 K87 K94 K95 M1 R2 K4 H6 K8 S17 G18 K19 V30 P32 Y35 V45 K46 K47 A48 V49 V51 G59 F60 H68 S70 K71 R73 R84 R86 K87 K94 K95
BS02 ZN BY C76 C79 C99 C102 C76 C79 C99 C102
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8h, PDBe:4v8h, PDBj:4v8h
PDBsum4v8h
PubMed22605777
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]