Structure of PDB 4v83 Chain BY

Receptor sequence

>4v83BY (length=62) Species: 262724 (Thermus thermophilus HB27)

MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKI
RDLKRQIARLLT

3D structure

• PDB: 4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
• Chain: BY
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BY	M1 L3 R7 N47 H48 R51 K54 R55 A58 R59	M1 L3 R7 N47 H48 R51 K54 R55 A58 R59

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v83, PDBe:4v83, PDBj:4v83
• PDBsum: 4v83
• PubMed: 21245352
• UniProt: Q72I12|RL29_THET2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)