Structure of PDB 4v7p Chain BY

Receptor sequence
>4v7pBY (length=62) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKI
RDLKRQIARLLT
3D structure
PDB4v7p Recognition of the amber UAG stop codon by release factor RF1.
ChainBY
Resolution3.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY M1 K2 L3 R7 Q46 N47 H48 I50 R51 R55 A58 R59 L61 M1 K2 L3 R7 Q46 N47 H48 I50 R51 R55 A58 R59 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum4v7p
PubMed20588254
UniProtQ72I12|RL29_THET2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]