Structure of PDB 4v6k Chain BY

Receptor sequence
>4v6kBY (length=70) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY
3D structure
PDB4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
ChainBY
Resolution8.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY R34 F36 Y37 E38 K39 R44 K45 R46 A47 K48 S50 A51 V52 K53 R54 H55 K57 K58 R61 E62 R65 R66 R68 R34 F36 Y37 E38 K39 R44 K45 R46 A47 K48 S50 A51 V52 K53 R54 H55 K57 K58 R61 E62 R65 R66 R68
BS02 rna BY R16 R17 R20 K24 R16 R17 R20 K24
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
PDBsum4v6k
PubMed21378755
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]