Structure of PDB 4v4z Chain BY

Receptor sequence
>4v4zBY (length=180) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDV
3D structure
PDB4v4z Structural basis for messenger RNA movement on the ribosome.
ChainBY
Resolution4.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY R112 H121 R122 I146 G147 S149 E169 T170 D179 R112 H121 R122 I146 G147 S149 E169 T170 D179
BS02 rna BY E11 E13 R19 P25 V27 Y29 H32 K36 R72 Q73 N75 K78 E84 H85 D87 F89 E97 E11 E13 R19 P25 V27 Y29 H32 K36 R72 Q73 N75 K78 E84 H85 D87 F89 E97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
PDBsum4v4z
PubMed17051149
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]