Structure of PDB 4v4r Chain BY

Receptor sequence
>4v4rBY (length=110) Species: 274 (Thermus thermophilus) [Search protein sequence]
SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGVRVNAGDTVEVLRG
DFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDL
EDEKREARLE
3D structure
PDB4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBY
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BY K2 Q3 D5 K6 Q7 R8 P15 H17 E18 H20 K21 Q22 R24 R32 R52 G53 D54 V65 D68 K81 T82 D83 D92 S94 K107 R111 K2 Q3 D5 K6 Q7 R8 P15 H17 E18 H20 K21 Q22 R24 R32 R49 G50 D51 V62 D65 K78 T79 D80 D89 S91 K104 R108
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum4v4r
PubMed16377566
UniProtP10972|RL24_HALMA Large ribosomal subunit protein uL24 (Gene Name=rpl24)

[Back to BioLiP]