Structure of PDB 8ove Chain BX

Receptor sequence

>8oveBX (length=117) Species: 5702 (Trypanosoma brucei brucei)

KAYTRPQFRRPHTYRRPATVKPSSNVSAIKNKWDAFRIIRYPLTTDKAMK
KIEENNTLTFIVDSRANKTEIKKAIRKLYQVKTVKVNTLIRPDGLKKAYI
RLSASYDALDTANKMGL

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BX
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BX	R51 F54 R55 R56 H58 T59 R61 R62 K67 T91 K93 K114 K131 N133 T134 L135 P138 Y145 R147	R5 F8 R9 R10 H12 T13 R15 R16 K21 T45 K47 K68 K85 N87 T88 L89 P92 Y99 R101
BS02	rna	BX	P52 Q53 N113 K114 I136	P6 Q7 N67 K68 I90
BS03	rna	BX	Y49 T59 S69 N71 N77 K78 S110 E116 K118 K119 R122 K128	Y3 T13 S23 N25 N31 K32 S64 E70 K72 K73 R76 K82

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: P41165|RL23A_TRYBB Large ribosomal subunit protein uL23 (Gene Name=RPL23A)