Structure of PDB 8ova Chain BX

Receptor sequence

>8ovaBX (length=120) Species: 5702 (Trypanosoma brucei brucei)

TKRKAYTRPQFRRPHTYRRPATVKPSSNVSAIKNKWDAFRIIRYPLTTDK
AMKKIEENNTLTFIVDSRANKTEIKKAIRKLYQVKTVKVNTLIRPDGLKK
AYIRLSASYDALDTANKMGL

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BX
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BX	R51 R55 R56 H58 T59 R61 R62 K67 T91 K93 K96 K114 K131 N133 T134 P138 Y145 R147	R8 R12 R13 H15 T16 R18 R19 K24 T48 K50 K53 K71 K88 N90 T91 P95 Y102 R104
BS02	rna	BX	P52 Q53 N113 K114	P9 Q10 N70 K71
BS03	rna	BX	T59 S69 N77 K78 S110 R111 E116 K119 R122 K128 T129	T16 S26 N34 K35 S67 R68 E73 K76 R79 K85 T86

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ova, PDBe:8ova, PDBj:8ova
• PDBsum: 8ova
• PubMed: 37985661
• UniProt: P41165|RL23A_TRYBB Large ribosomal subunit protein uL23 (Gene Name=RPL23A)