Structure of PDB 6ydp Chain BX

Receptor sequence
>6ydpBX (length=149) Species: 9823 (Sus scrofa) [Search protein sequence]
ARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRV
DLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLAL
GQTFTFPDLFPERKGASVDVDVRDQVLEDQRQKHSPDPRRGGVPGWFGL
3D structure
PDB6ydp Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.
ChainBX
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BX N4 Y7 L9 G32 Q41 T49 R50 V51 R54 R69 R71 Q73 Y74 S76 N77 R78 R79 R80 R83 N84 K93 Y96 N3 Y6 L8 G31 Q40 T48 R49 V50 R53 R68 R70 Q72 Y73 S75 N76 R77 R78 R79 R82 N83 K92 Y95
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:34:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ydp', asym_id = 'BX', title = 'Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ydp', asym_id='BX', title='Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6ydp', asym_id = 'BX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6ydp', asym_id='BX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>