Structure of PDB 5aj4 Chain BX

Receptor sequence
>5aj4BX (length=134) Species: 9823 (Sus scrofa) [Search protein sequence]
ARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRV
DLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLAL
GQTFTFPDLFPERKGRQKHSPDPRRGGVPGWFGL
3D structure
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
ChainBX
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BX N4 G32 Q35 T49 R50 V51 R54 R69 R71 V72 Q73 Y74 S76 N77 R78 R79 R83 N84 K93 Y96 N3 G31 Q34 T48 R49 V50 R53 R68 R70 V71 Q72 Y73 S75 N76 R77 R78 R82 N83 K92 Y95
BS02 MG BX R50 T70 K93 R49 T69 K92
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Apr 28 14:48:31 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'BX', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='BX', title='The complete structure of the 55S mammalian mitochondrial ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5aj4', asym_id = 'BX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5aj4', asym_id='BX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>