Structure of PDB 4v9r Chain BX

Receptor sequence

>4v9rBX (length=95) Species: 274 (Thermus thermophilus)

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

• PDB: 4v9r The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
• Chain: BX
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BX	K2 S14 K16 K25 H31 T35 K36 T37 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80	K2 S14 K16 K25 H31 T35 K36 T37 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80
BS02	MG	BX	P32 R76	P32 R76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9r, PDBe:4v9r, PDBj:4v9r
• PDBsum: 4v9r
• PubMed: 24412368
• UniProt: Q5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)