Structure of PDB 4v8z Chain BX

Receptor sequence
>4v8zBX (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI
3D structure
PDB4v8z Molecular architecture of a eukaryotic translational initiation complex.
ChainBX
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BX R33 L34 K36 R42 K45 N91 K92 Y93 N111 T112 L113 P116 K120 Y123 R125 R11 L12 K14 R20 K23 N69 K70 Y71 N89 T90 L91 P94 K98 Y101 R103
BS02 rna BX P35 R42 S48 K49 H53 Y54 R56 K61 Y93 Q94 P13 R20 S26 K27 H31 Y32 R34 K39 Y71 Q72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
PDBsum4v8z
PubMed24200810
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]