Structure of PDB 4v83 Chain BX

Receptor sequence
>4v83BX (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainBX
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BX S8 Q19 R20 R21 K23 R26 G29 G31 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 E57 S65 H66 K69 G79 K92 S1 Q12 R13 R14 K16 R19 G22 G24 K26 T27 T28 K32 R33 R34 Q35 Y36 P37 N38 Q40 K41 E50 S58 H59 K62 G72 K85
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]