Structure of PDB 4v6i Chain BX

Receptor sequence

>4v6iBX (length=122) Species: 4932 (Saccharomyces cerevisiae)

KKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSE
TAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTK
KAYVRLTADYDALDIANRIGYI

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BX
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BX	K22 L24 K25 P35 K36 L38 K39 L40 K45 A47 S48 A50 S69 T71 N91 K92 Y93 N111 T112 L113 V114 K121 R125	K2 L4 K5 P15 K16 L18 K19 L20 K25 A27 S28 A30 S49 T51 N71 K72 Y73 N91 T92 L93 V94 K101 R105
BS02	rna	BX	R27 P44 Y54 L57 D58 Y60 K89 Y93	R7 P24 Y34 L37 D38 Y40 K69 Y73

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)