Structure of PDB 4v4y Chain BX

Receptor sequence
>4v4yBX (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALDTEE
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainBX
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BX M1 R2 K4 H6 K8 A16 S17 K28 V30 V42 I44 V45 K46 A48 Q57 K63 P66 L67 H68 P82 T83 R84 K94 L106 M1 R2 K4 H6 K8 A16 S17 K28 V30 V42 I44 V45 K46 A48 Q57 K63 P66 L67 H68 P82 T83 R84 K94 L106
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]