Structure of PDB 4v4s Chain BX

Receptor sequence
>4v4sBX (length=76) Species: 274 (Thermus thermophilus) [Search protein sequence]
SWDVIKHPHVTEKAMNDMDFNKLQFAVDDRASKGEVADAVEEQYDVTVEQ
VNTQNTMDGEKKAVVRLSEDDDQEVA
3D structure
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBX
Resolution6.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BX W2 T11 E12 K13 K23 S33 K34 E36 D39 E42 E43 T48 N53 T54 Q55 N56 T57 M58 K63 R67 W2 T11 E12 K13 K22 S32 K33 E35 D38 E41 E42 T47 N52 T53 Q54 N55 T56 M57 K62 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtP12732|RL23_HALMA Large ribosomal subunit protein uL23 (Gene Name=rpl23)

[Back to BioLiP]