Structure of PDB 1vy4 Chain BX

Receptor sequence

>1vy4BX (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

PDB

1vy4 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BX	K2 S14 K16 K25 H31 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80	K2 S14 K16 K25 H31 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80
BS02	MG	BX	V30 R76 K77	V30 R76 K77

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy4, PDBe:1vy4, PDBj:1vy4
PDBsum	1vy4
PubMed	25132179
UniProt	Q5SHP0\|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)