Structure of PDB 7o0v Chain BW

Receptor sequence
>7o0vBW (length=40) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
GGMTEEEARRFHGYMVTGTLGYVVVASVAHFLAWSWRPWF
3D structure
PDB7o0v 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
ChainBW
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BCL BW Y26 V29 A30 A33 H34 Y22 V25 A26 A29 H30
BS02 V7N BW R14 F15 Y18 G22 T23 R10 F11 Y14 G18 T19
BS03 BCL BW Y26 A30 H34 W43 F44 Y22 A26 H30 W39 F40
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7o0v, PDBe:7o0v, PDBj:7o0v
PDBsum7o0v
PubMed35171663
UniProtA0A143BHS8

[Back to BioLiP]