Structure of PDB 7am2 Chain BW

Receptor sequence

>7am2BW (length=447) Species: 5689 (Leishmania tarentolae)

SPARTAQSPLLAKPVKTKVVDNFADMLVTPALQEALADMGVSTPSPIQQT
AIEAVLQRKNTVIAAPHGEGKTLAYLLPLYQNMEKDRDVYKIPLRERRPR
MILLAPTKELVEQLQTVCARLDAATGLTSVCFTSRKRSKYHLSRMLKNTM
ADVLVMDPKLILRLLRTRRLFIEDLRYFAVDEADAMMSSLHDHDAVQLLM
KVQKRNQFKYLWPVQTQYVFVTAYMTRKLEYIVGRKISDPVTCMFRQLMH
RPQARLRHRFYAIRREPEKFTVLMHLLRKNGHVPLPFAEGRRTIIFFRNI
DATTAVFHQLRSAGFAVSLLHASLPYKVRKEMYADFASGRTNILCATDVA
ARGLDLHVDMVINFDVPTNALAYLSRSGRTARMGREGQVLNLYNKHQGVI
VSAIKAFLKDNLPMEGLTNRKADMMQPRYAEWRTHKINALARSYVSL

3D structure

• PDB: 7am2 Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis.
• Chain: BW
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BW	P106 V107 T109 K110 P198 T199 K200 S226 R227 R229 S230 D249 K251 L252 R258 S281 L282 H283 D284 H285 Q289 M292 K320 Y323 I324 R327 K328 R338 R514 N515 I516 A538 T563 V565 K611 H612 A638 D639 M640 E647 W648 R649 T650 N654 A655 L656	P14 V15 T17 K18 P106 T107 K108 S134 R135 R137 S138 D157 K159 L160 R166 S189 L190 H191 D192 H193 Q197 M200 K228 Y231 I232 R235 K236 R246 R298 N299 I300 A322 T347 V349 K395 H396 A422 D423 M424 E431 W432 R433 T434 N438 A439 L440
BS02	rna	BW	K228 Y542 K543	K136 Y326 K327
BS03	ATP	BW	V133 T135 Q140 H159 G160 G162 K163 T164 D571 M599	V41 T43 Q48 H67 G68 G70 K71 T72 D355 M383

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0004386 helicase activity
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:1902775 mitochondrial large ribosomal subunit assembly

Cellular Component

• GO:0005739 mitochondrion

External links

• PDB: RCSB:7am2, PDBe:7am2, PDBj:7am2
• PDBsum: 7am2
• PubMed: 33168716
• UniProt: Q4QHU1