Structure of PDB 6skg Chain BW

Receptor sequence
>6skgBW (length=85) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
MDPYKVIIRPLVTEKAVSLIERENKLTFIVDRRATKQDIKRAVEEMFNVK
VAKVNTLVTMKGEKKAYVKLKPEYDASEIAARLGL
3D structure
PDB6skg Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBW
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BW K5 K15 K36 K53 N55 M60 K64 K65 Y67 K5 K15 K36 K53 N55 M60 K64 K65 Y67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skg, PDBe:6skg, PDBj:6skg
PDBsum6skg
PubMed32555463
UniProtQ5JDH1|RL23_THEKO Large ribosomal subunit protein uL23 (Gene Name=rpl23)

[Back to BioLiP]