Structure of PDB 4v8b Chain BW

Receptor sequence
>4v8bBW (length=66) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDL
KRQIARLLTVLNEKRR
3D structure
PDB4v8b A new understanding of the decoding principle on the ribosome.
ChainBW
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BW R7 L10 R14 Q46 N47 H48 I50 R51 K54 R55 A58 R59 L61 T62 N65 R4 L7 R11 Q43 N44 H45 I47 R48 K51 R52 A55 R56 L58 T59 N62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8b, PDBe:4v8b, PDBj:4v8b
PDBsum4v8b
PubMed22437501
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]