Structure of PDB 4v6k Chain BW

Receptor sequence
>4v6kBW (length=91) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK
3D structure
PDB4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
ChainBW
Resolution8.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BW K89 K90 K89 K90
BS02 rna BW P1 R2 S3 K5 K6 F9 H13 K16 K17 R31 W33 R35 R36 H51 N52 G53 R54 K69 G71 E72 T76 R77 T78 Y79 R80 G81 H82 P1 R2 S3 K5 K6 F9 H13 K16 K17 R31 W33 R35 R36 H51 N52 G53 R54 K69 G71 E72 T76 R77 T78 Y79 R80 G81 H82
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
PDBsum4v6k
PubMed21378755
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]