Structure of PDB 4v6i Chain BW

Receptor sequence
>4v6iBW (length=105) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SRKQKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVT
VTEDGTVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRL
AFYQV
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBW
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BW P22 V43 F71 G73 K74 Y75 K77 Y78 K81 K82 L84 K85 K86 W92 F95 T98 T100 Y103 Y108 P17 V38 F66 G68 K69 Y70 K72 Y73 K76 K77 L79 K80 K81 W87 F90 T93 T95 Y98 Y103
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]