Structure of PDB 4v5o Chain BW

Receptor sequence

>4v5oBW (length=259) Species: 5911 (Tetrahymena thermophila)

ARGPKKHLKRINAPKSWMLNKLGGIWATRPSQGPHKLRESLPLSVLLKER
LNYALNGRDVTLILNDKEQNVFVDGKVRRDKGYPTGLMDVVRIEKTDQSF
RILYDTKGRFVLKSLSKEEAKYKLLKVTAKAIGPNQIPYIVTHDSRTIRF
PNPEIKIGDTLKYDLVNNKIENFAHLESGNVCYIQQGNNIGRVGIIQHIE
KHQGSFDICHVKDAKGNAFATRLGNIFVLGQGKKSWIELPSGDGVRETIL
EERKRKFSY

3D structure

• PDB: 4v5o Crystal Structure of the Eukaryotic 40S Ribosomal Subunit in Complex with Initiation Factor 1.
• Chain: BW
• Resolution: 3.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BW	R3 G4 P5 K7 H8 K10 R11 I12 M19 K22 L23 I26 W27 A28 T29 R30 Q33 G34 K37 L38 N57 G58 N66 D67 K68 R79 K108 R110 K131 I133 G134 N136 Q137 S146 T148 R150 K157 I158 N189 H199 Q204 A221 R223 I250 K257	R2 G3 P4 K6 H7 K9 R10 I11 M18 K21 L22 I25 W26 A27 T28 R29 Q32 G33 K36 L37 N56 G57 N65 D66 K67 R78 K107 R109 K130 I132 G133 N135 Q136 S145 T147 R149 K156 I157 N188 H198 Q203 A220 R222 I249 K256

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5o, PDBe:4v5o, PDBj:4v5o
• PDBsum: 4v5o
• PubMed: 21205638
• UniProt: P0C233|RS4_TETTH Small ribosomal subunit protein eS4