Structure of PDB 4v82 Chain BV

Receptor sequence
>4v82BV (length=137) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
3D structure
PDB4v82 Structural basis of cyanobacterial photosystem II Inhibition by the herbicide terbutryn
ChainBV
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM BV A5062 C5063 C5066 H5067 T5072 T5074 L5078 D5079 L5080 L5085 Y5101 M5102 Y5108 H5118 M5130 A36 C37 C40 H41 T46 T48 L52 D53 L54 L59 Y75 M76 Y82 H92 M104
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0018063 cytochrome c-heme linkage
GO:0019684 photosynthesis, light reaction
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v82, PDBe:4v82, PDBj:4v82
PDBsum4v82
PubMed21367867
UniProtP0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]