Structure of PDB 4v6i Chain BV

Receptor sequence

>4v6iBV (length=170) Species: 4932 (Saccharomyces cerevisiae)

MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQ
VLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAA
NAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVV
TEKEEAVAKAAEKKVVRLTS

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BV
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BV	M1 A2 R3 S16 R18 R23 S25 K27 W39 R62 F63 N64 S65 S66 G68 R69 T70 A71 Q72 G77 R82 W83 P84 A85 K86 N101 K105 H116 Q118 V119 R127 Y130 R131 A132 H133 G134 R135 N137 K138 Y139 E140	M1 A2 R3 S16 R18 R23 S25 K27 W39 R62 F63 N64 S65 S66 G68 R69 T70 A71 Q72 G77 R82 W83 P84 A85 K86 N101 K105 H116 Q118 V119 R127 Y130 R131 A132 H133 G134 R135 N137 K138 Y139 E140
BS02	rna	BV	Y4 G5 R61 R62 A122	Y4 G5 R61 R62 A122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)