Structure of PDB 4v4y Chain BV

Receptor sequence

>4v4yBV (length=110) Species: 300852 (Thermus thermophilus HB8)

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEK

3D structure

• PDB: 4v4y Structural basis for messenger RNA movement on the ribosome.
• Chain: BV
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BV	K4 I6 A7 R8 R11 R15 K16 R18 R25 N40 K41 R42 K49 E52 S53 N57 N61 Y75 D77 G79 P80 L82 R84 L86 P87 R88 A89 R90 G91 R92 I95 I96 K98 R99	K4 I6 A7 R8 R11 R15 K16 R18 R25 N40 K41 R42 K49 E52 S53 N57 N61 Y75 D77 G79 P80 L82 R84 L86 P87 R88 A89 R90 G91 R92 I95 I96 K98 R99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
• PDBsum: 4v4y
• PubMed: 17051149
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)