Structure of PDB 4v4s Chain BV

Receptor sequence
>4v4sBV (length=100) Species: 274 (Thermus thermophilus) [Search protein sequence]
MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGED
AGKYTVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGIQG
3D structure
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBV
Resolution6.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BV G8 K10 V22 E23 S24 L25 K68 R72 Q79 Y80 R81 R82 T84 G85 H86 R87 F90 G8 K10 V22 E23 S24 L25 K68 R72 Q79 Y80 R81 R82 T84 G85 H86 R87 F90
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtQ9RY64|RL21_DEIRA Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]