Structure of PDB 3j9w Chain BV

Receptor sequence

>3j9wBV (length=109) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK

3D structure

• PDB: 3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
• Chain: BV
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BV	K4 V6 A7 R8 R11 R15 K16 R18 R25 R41 A42 K52 A56 N57 H60 D77 E78 G79 P80 T81 R84 R86 P87 R88 A89 G91 A93 Q95 N97 K98 R99 H102	K3 V5 A6 R7 R10 R14 K15 R17 R24 R40 A41 K51 A55 N56 H59 D76 E77 G78 P79 T80 R83 R85 P86 R87 A88 G90 A92 Q94 N96 K97 R98 H101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
• PDBsum: 3j9w
• PubMed: 25903689
• UniProt: P42060|RL22_BACSU Large ribosomal subunit protein uL22 (Gene Name=rplV)