Structure of PDB 8ove Chain BU

Receptor sequence

>8oveBU (length=151) Species: 5702 (Trypanosoma brucei brucei)

VHSHGYKCGTRHLFAKKFRKHGVPSVSTILTNFKVGDYVDVVADAAVRAG
MPHKYYHGRTGIVWNVTPRGVGVIINKPVRNRTVRKRICVRFEHVRKSRC
QEAFKQKLKDLEAFRAAKKAKKVSTRNGGFVCPKKVEVLARRTADYEAMI
P

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BU
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	H13 F19 Y39 H58 G59 R60 T61 R81 R100 C101 Q102 R116 F137	H12 F18 Y38 H57 G58 R59 T60 R80 R99 C100 Q101 R115 F130
BS02	rna	BU	V2 H3 S4 H5 G6 Y7 K8 C9 R12 K17 H22 G23 R49 G51 H54 Y57 R60 T68 R70 K78 V80 R83 K87 R88 C90	V1 H2 S3 H4 G5 Y6 K7 C8 R11 K16 H21 G22 R48 G50 H53 Y56 R59 T67 R69 K77 V79 R82 K86 R87 C89
BS03	rna	BU	S26 S28	S25 S27

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: Q4FKD4