Structure of PDB 8oit Chain BU

Receptor sequence

>8oitBU (length=222) Species: 9606 (Homo sapiens) [Search protein sequence]

VKTLLPVPSFEDVSIPEKPKLRFIERAPLVPKVRREPKNLSDIRGPSTEA
TEFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFK
PITRKSVGHRMGGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQV
AHKLPFAAKAVSRGTLEKMRKDQEERERNNQNPWTFERIATANMLGIRKV
LSPYDLTHKGKYWGKFYMPKRV

3D structure

PDB

8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BU	K31 R63 R64 P66 K67 N68 L69 R73 Y96 G100 H101 M104 R111 R133 K134 R139 M140 G141 G143 K144 Q178 K182 L183 P184 R227 K228 V229 L230 S231 P232 Y233 K244	K2 R34 R35 P37 K38 N39 L40 R44 Y67 G71 H72 M75 R82 R104 K105 R110 M111 G112 G114 K115 Q149 K153 L154 P155 R198 K199 V200 L201 S202 P203 Y204 K215

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oit, PDBe:8oit, PDBj:8oit
PDBsum	8oit
PubMed	37141370
UniProt	Q9NX20\|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]